PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK14882.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family GRAS
Protein Properties Length: 428aa    MW: 48722.8 Da    PI: 6.6003
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK14882.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS295.41.5e-90544262374
       GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlar.svselykal.ppsetseknsseelaalkl....fsevsPilkfsh 95 
                v lLl+ Ae +  ++   a +lL    +las++g+p+qR+a yf eAL++++ + s+ +++k l +  e+   + ++++++       f++  P+ ++  
  PK14882.1  54 VGLLLASAEKIGCQQYDSACRLLHFCDDLASNSGNPVQRAAYYFCEALREKIDKeSGRNTSKGLgRILESF--DLDKAMMVPDEpklaFHQGLPLSQVEK 151
                6799*************************************************988888888884444443..344444443223447************ PP

       GRAS  96 ltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegpp..slRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledlelee 193
                ++  qaI e v+++++vH+iDf i +G+QW+aL+qaLa+R e  p  s++iT+++    +sk+ +eetg+ L++fA++l++pf+fn+++++++ +l+ ++
  PK14882.1 152 FAGIQAIIEKVSESKKVHVIDFRIANGVQWIALMQALATRHEYFPieSFKITVIAT---SSKHVMEETGKWLTNFANTLKIPFSFNIIMVSNMFELKEDR 248
                *****************************************766656********9...5899************************************* PP

       GRAS 194 LrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgre 293
                ++++++E++aV ++++l  + +++++les    +++++ksl+P v+v++e ea+hns+ F++rf+eal +y +lfd+le+ + r++ +r+ vE+ +  ++
  PK14882.1 249 FELDNDETIAVYSSFALRGMIAQPAELES----LMRVIKSLNPCVMVITEVEANHNSPAFVNRFIEALFFYGTLFDCLESFMKRNEPNRTEVEATYCFKA 344
                *****************************....******************************************************************* PP

       GRAS 294 ivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                i+n+va+eg+er+ r+ +   Wr+ + ++G+++++ls +   qa+l++++++ +   ++  + ++l++gWk+ pL s+S+Wr
  PK14882.1 345 IRNIVATEGKERNIRNVKIDVWRAFFARFGMEELELSPSSIYQANLIVNRFPsGTYCTLGMNGKCLMMGWKGTPLQSLSVWR 426
                ****************************************************55557888999******************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098543.02327405IPR005202Transcription factor GRAS
PfamPF035145.1E-8854426IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 428 aa     Download sequence    Send to blast
XAAADHRILS TEEILRFAGE RFIQSYSKQQ AVSHPFNWSF SGLNFEQTKD VELVGLLLAS  60
AEKIGCQQYD SACRLLHFCD DLASNSGNPV QRAAYYFCEA LREKIDKESG RNTSKGLGRI  120
LESFDLDKAM MVPDEPKLAF HQGLPLSQVE KFAGIQAIIE KVSESKKVHV IDFRIANGVQ  180
WIALMQALAT RHEYFPIESF KITVIATSSK HVMEETGKWL TNFANTLKIP FSFNIIMVSN  240
MFELKEDRFE LDNDETIAVY SSFALRGMIA QPAELESLMR VIKSLNPCVM VITEVEANHN  300
SPAFVNRFIE ALFFYGTLFD CLESFMKRNE PNRTEVEATY CFKAIRNIVA TEGKERNIRN  360
VKIDVWRAFF ARFGMEELEL SPSSIYQANL IVNRFPSGTY CTLGMNGKCL MMGWKGTPLQ  420
SLSVWRFH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A7e-428342633375GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010097792.10.0hypothetical protein L484_004206
TrEMBLW9R5C50.0W9R5C5_9R
STRINGPOPTR_0010s15370.11e-164(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF47933162
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66350.18e-55RGA-like 1